Bacterial taxon 1392858
Locus CO715_21195
Protein ATI08021.1
hypothetical protein
Escherichia coli M12
Length 207 aa, Gene n/a, UniProt n/a
>ATI08021.1|Escherichia coli M12|hypothetical protein
MRHGLLALICWLCCVVAHSEMLNVEQSGLFRAWFVRIAQEQLRQGPSPRWYQQDCAGLVRFSANEALKIHDSKWLKSNGIASQYLPPEMTLTPEQRQLAQNWNQGNGKTGPYVTAINLIQYNSQFIGQDINQALPGDMIFFDQGDAQHLMVWMGRYVIYHTGSATKTDNGMRAVSLQQLMTWKDTRWIPNDSNPNFIGIYRLNFLAR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -6.95 | 1.7e-20 | ●○○○○ -0.9 | -0.9035553764831018 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 3.33 | 1.2e-22 | ○○○○○ 1.24 | 1.240073773909699 | 29101196 |
Retrieved 2 of 2 entries in 1.2 ms
(Link to these results)