Bacterial taxon 1392858
Locus CO715_22185
Protein ATI08201.1
hypothetical protein
Escherichia coli M12
Length 72 aa, Gene n/a, UniProt n/a
>ATI08201.1|Escherichia coli M12|hypothetical protein
MPKTPRVYVAFCFYICNLNAALAMLGKFLDFAGVLCNLHIKWLIFAQDWWVRNGLSLLNKGLRGYTSANNFL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 6.09 | 0.025 | ○○○○○ 1.82 | 1.8171886493220488 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 7.11 | 0.014 | ○○○○○ 2.03 | 2.0302162298701365 | 29101196 |
Retrieved 2 of 2 entries in 2 ms
(Link to these results)