Bacterial taxon 1392858
Locus CO715_22480
Protein ATI08894.1
hypothetical protein
Escherichia coli M12
Length 98 aa, Gene n/a, UniProt n/a
>ATI08894.1|Escherichia coli M12|hypothetical protein
MLSGAYLQRAGVFSLQQPMPPGIKPPQHCASPEPFRLAADSTAIFVRRNPSLLHSVLRIPQNIIRLQPLHFSYEKGRRVLSLRPDPGANCHYGSLTPV
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -3.66 | 3.5e-135 | ●○○○○ -0.22 | -0.21690134359009938 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 1.26 | 2.1e-19 | ○○○○○ 0.81 | 0.8098456925285469 | 29101196 |
Retrieved 2 of 2 entries in 1.1 ms
(Link to these results)