Bacterial taxon 1392858
Locus CO715_22550
Protein ATI08263.1
hypothetical protein
Escherichia coli M12
Length 237 aa, Gene n/a, UniProt n/a
>ATI08263.1|Escherichia coli M12|hypothetical protein
MNVNYLNDSDLDFLQHCSEEQLANFARLLTHNEKGKTRLSSVLMRNELFKSMEGHPEQHRRNWQLIAGELQHFGGDSIANKLRGHGKLYRAILLDVSKRLKLKADKEMSTFEIEQQLLEQFLRNTWKKMDEEHKQEFLHAVDARVNELEELLPLLMKDKLLAKGVSHLLSSQLTRILRTHAAMSVLGHGLLRGAGLGGPVGAALNGVKAVSGSAYRVTIPAVLQIACLRRMVSATQV
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -8.82 | 2.3e-14 | ●●○○○ -1.29 | -1.2930974850857255 | 29101196 |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 3.17 | 1.4e-8 | ○○○○○ 1.21 | 1.2075249956868763 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)