Bacterial taxon 1392858
Locus CO715_23135
Protein ATI08364.1
hypothetical protein
Escherichia coli M12
Length 85 aa, Gene n/a, UniProt n/a
>ATI08364.1|Escherichia coli M12|hypothetical protein
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRAQLDNR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 7.07 | 1.1e-53 | ○○○○○ 2.02 | 2.0208271592289377 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 7.81 | 9.8e-67 | ○○○○○ 2.18 | 2.175016563758846 | 29101196 |
Retrieved 2 of 2 entries in 28.8 ms
(Link to these results)