Bacterial taxon 1392858
Locus CO715_23315
Protein ATI08391.1
hypothetical protein
Escherichia coli M12
Length 151 aa, Gene n/a, UniProt n/a
>ATI08391.1|Escherichia coli M12|hypothetical protein
MIHLFKTCMITAFILGLTWSAPLRAQDQRYISIRNTDTIWLPGNICAYQFRLDNGGNDEGFGPLTITLQLKDKYGQTLVTRKMETEAFGDSNATRTTDAFLETECVENVATTEIIKATEESNGHRVSLPLSVFNPQDYHPLLITVSGKNVN
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -6.07 | 0.00089 | ●○○○○ -0.72 | -0.721198760029597 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 4.25 | 0.00011 | ○○○○○ 1.43 | 1.4324453990471488 | 29101196 |
Retrieved 2 of 2 entries in 1.1 ms
(Link to these results)