Bacterial taxon 1392858
Locus CO715_24135
Protein ATI08528.1
hypothetical protein
Escherichia coli M12
Length 122 aa, Gene n/a, UniProt n/a
>ATI08528.1|Escherichia coli M12|hypothetical protein
MWLLDQWAERHITEAQSKGEFDNLPGSGEPLILDDDSHVPPELRAGYRLLKNAGCLPPELEQRREAIQLLDILKGIRHDDPQYKEVSRRLSLLELKLRQAGLSTDFLRGDYADKLLNKINDN
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -5.47 | 5.1e-6 | ●○○○○ -0.59 | -0.5945506293805382 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 3.56 | 8.3e-5 | ○○○○○ 1.29 | 1.2891055872581811 | 29101196 |
Retrieved 2 of 2 entries in 2.1 ms
(Link to these results)