Bacterial taxon 1392858
Locus CO715_24280
Protein ATI08553.1
hypothetical protein
Escherichia coli M12
Length 261 aa, Gene n/a, UniProt n/a
>ATI08553.1|Escherichia coli M12|hypothetical protein
MNSKKVCCICVLFSLLAGCASESPIDEKKKKAQVTQSNINKNTPPQLTDKDLFGNETTLAVSEEDIQAALEGDEFRVPLSSPVILVQSGSRAPETIMQEEMRKYYTVATFSGIPDRQKTLTCNKDKNKDESLDIVDAENMNWMQALRFVAAKGHQKAIIVFQDTLQTGKYDSGLKSIVWTDYKNQKLTDTMSLRYLVRFTLVDVATGEWATWSPVNYESKLIFPQIGNKNSDSLDVAEQQISQLKQKTYAAVVKDLVNRYQ
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -2.53 | 9.4e-25 | ○○○○○ 0.02 | 0.01782542243986954 | 29101196 |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 0.54 | 0.026 | ○○○○○ 0.66 | 0.6579513941553758 | 29101196 |
Retrieved 2 of 2 entries in 0.7 ms
(Link to these results)