Bacterial taxon 1392858
Locus CO715_24315
Protein ATI08560.1
hypothetical protein
Escherichia coli M12
Length 257 aa, Gene n/a, UniProt n/a
>ATI08560.1|Escherichia coli M12|hypothetical protein
MSDISDMGEPSVFPMEPESGTSGRQYRLALRGNSLNPMIDAATPLLGMVMRLSTMNSQAMPEHLFAQVVTDVQAVEQLLQEQGYEPGVIVSFRYILCTFIDEAALGNGWSNKNEWIKQSLLVHFHNEAWGGEKVFILLERLIREPVRYQDLLEFLYLCFSLGFRGRYKVAIQQQDEFERIYQRLHHALHKLRGDAPFPLLHQKNNIQGGRYQLIRRLTIRHVLCGGLVVLAVFYLFYLLRLDSQTQDILHQLNKLLR
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -3.39 | 2.9e-25 | ●○○○○ -0.16 | -0.1609842117714045 | 29101196 |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -0.88 | 0.011 | ○○○○○ 0.36 | 0.3616740539219929 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)