Bacterial taxon 1392858
Locus CO715_24470
Protein ATI08586.1
hypothetical protein
Escherichia coli M12
Length 165 aa, Gene n/a, UniProt n/a
>ATI08586.1|Escherichia coli M12|hypothetical protein
MSEYRRYYIKGGTWFFTVNLRNRRSQLLTTQYQTLRNAIIKVKQARPFEINAWVVLPEHMHCIWTLPESDDDFSSRWREIKKQFTHACGLKNIWQPRFWEHAIRNTKDYRHHVDYIYINPVKHGWVKQVSDWPFSTFHRDVARGLYPIDWAGDITDFSAGERIIL
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 1.77 | 0.0043 | ○○○○○ 0.92 | 0.9152119297242218 | 29101196 |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 3.56 | 1.3e-9 | ○○○○○ 1.29 | 1.287853711172688 | 29101196 |
Retrieved 2 of 2 entries in 1 ms
(Link to these results)