Bacterial taxon 1392858
Locus CO715_06755
Protein ATI05441.1
inhibitor of g-type lysozyme
Escherichia coli M12
Length 133 aa, Gene n/a, UniProt n/a
>ATI05441.1|Escherichia coli M12|inhibitor of g-type lysozyme
MKIKGISKAVLLLALLTSTSFAAGKNVNVEFRKGHSSAQYSGEIKGYDYDTYTFYAKKGQKVHVSISNEGADTYLFGPGIDDSVDLSRYSPELDSHGQYSLPASGKYELRVLQTRNDARKNKTKKYNVDIQIK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -7.53 | 6.2e-43 | ●●○○○ -1.03 | -1.0256132948186856 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 1.2 | 0.021 | ○○○○○ 0.8 | 0.7969096396451175 | 29101196 |
Retrieved 2 of 2 entries in 1.2 ms
(Link to these results)