Bacterial taxon 1392858
Locus CO715_18460
Protein ATI07526.1
inovirus Gp2 family protein
Escherichia coli M12
Length 65 aa, Gene n/a, UniProt n/a
>ATI07526.1|Escherichia coli M12|inovirus Gp2 family protein
MPQDDFCIVNPGGCIVHFPANGRYILDIHDPDFPEQYQRLLARLDYLTKPDTKASGQRNSGYSGF
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -3.95 | 3.5e-18 | ●○○○○ -0.28 | -0.2784519177935134 | 29101196 |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 1.63 | 0.00019 | ○○○○○ 0.89 | 0.8862101337436301 | 29101196 |
Retrieved 2 of 2 entries in 0.9 ms
(Link to these results)