Bacterial taxon 1392858
Locus CO715_23520
Protein ATI08418.1
iron export ATP-binding protein FetA
Escherichia coli M12
Length 225 aa, Gene n/a, UniProt n/a
>ATI08418.1|Escherichia coli M12|iron export ATP-binding protein FetA
MQENSPLLQLQNVGYLAGDAKILNNINFSLRAGEFKLITGPSGCGKSTLLKIVASLISPTSGTLLFEGEDVSTLKPEIYRQQVSYCAQTPTLFGDTVYDNLIFPWQIRNQQPDPAIFLDFLERFALPDSILTKNIAELSGGEKQRISLIRNLQFMPKVLLLDEITSALDESNKHNVNEMIHRYVREQNIAVLWVTHDKDEINHADKVITLQPHAGEMQEARYELA
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -2.82 | 6.7e-23 | ●○○○○ -0.04 | -0.041847337635304786 | 29101196 |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -1.2 | 1.7e-5 | ○○○○○ 0.3 | 0.29511597537660617 | 29101196 |
Retrieved 2 of 2 entries in 0.7 ms
(Link to these results)