Bacterial taxon 1392858
Locus CO715_14195
Protein ATI06755.1
iron-hydroxamate transporter substrate-binding subunit
Escherichia coli M12
Length 296 aa, Gene n/a, UniProt n/a
>ATI06755.1|Escherichia coli M12|iron-hydroxamate transporter substrate-binding subunit
MSGLPLISRRRLLTAMALSPLLWQMNTAHAAAIDPNRIVALEWLPVELLLALGIVPYGVADTINYRLWVSEPPLPDSVIDVGLRTEPNLELLTEMKPSFMVWSAGYGPSPEMLARIAPGRGFNFSDGKQPLAMARKSLTEMADLLNLQRAAETHLAQYEDFIRSMKPRFVKRGARPLLLTTLIDPRHMLVFGPNSLFQEILDEYGIPNAWQGETNFWGSTAVSIDRLAAYKDVDVLCFDHDNSKDMDALMATPLWQAMPFVRAGRFQRVPAVWFYGATLSAMHFVRILDNAIGGKA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -8.26 | 1.3e-7 | ●●○○○ -1.18 | -1.1762557171063637 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -4.17 | 0.0008 | ●○○○○ -0.32 | -0.3231021648427698 | 29101196 |
Retrieved 2 of 2 entries in 1.6 ms
(Link to these results)