Bacterial taxon 1392858
Locus CO715_07705
Protein ATI05609.1
IS66 family insertion sequence hypothetical protein
Escherichia coli M12
Length 115 aa, Gene n/a, UniProt n/a
>ATI05609.1|Escherichia coli M12|IS66 family insertion sequence hypothetical protein
MIPLPSGTKIWLVAGITDMRNGFNGLAAKVQTALKDDPMSGHVFIFRGRSGSQVKLLWSTGDGLCLLTKRLERGRFAWPSARDGKVFLTQAQLAMLLEGIDWRQPKRLLTSLTML
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -8.77 | 1.7e-46 | ●●○○○ -1.28 | -1.2843343524872735 | 29101196 |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -2.33 | 4.8e-7 | ○○○○○ 0.06 | 0.06059785536088611 | 29101196 |
Retrieved 2 of 2 entries in 1.1 ms
(Link to these results)