Bacterial taxon 1392858
Locus CO715_12290
Protein ATI08796.1
L(+)-tartrate dehydratase subunit alpha
Escherichia coli M12
Length 278 aa, Gene n/a, UniProt n/a
>ATI08796.1|Escherichia coli M12|L(+)-tartrate dehydratase subunit alpha
STRMPDDVVDKLKQLKDAETSSMGKIIYHTMFDNMQKAIDLNRPACQDTGEIMFFVKVGSRFPLLGELQSILKQAVEEATVKAPLRHNAVEIFDEVNTGKNTGSGVPWVTWDIVPDGDDAEIEVYMAGGGCTLPGRSKVLMPSEGYEGVVKFVFENISTLAVNACPPVLVGVGIATSVETAAMLSRKAILRPIGSRHPNPKAAELELRLEEGLNRLGIGPQGLTGNSSVMGVHIESAARHPSTIGVAVSTGCWAHRRGTLLVHADLSFENLSHTRSAL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -6.54 | 8.4e-9 | ●○○○○ -0.82 | -0.8186364486838154 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 3.47 | 3.9e-6 | ○○○○○ 1.27 | 1.2707447380042813 | 29101196 |
Retrieved 2 of 2 entries in 0.9 ms
(Link to these results)