Bacterial taxon 1392858
Locus CO715_18935
Protein ATI07608.1
L-amino acid N-acyltransferase MnaT
Escherichia coli M12
Length 172 aa, Gene n/a, UniProt n/a
>ATI07608.1|Escherichia coli M12|L-amino acid N-acyltransferase MnaT
MSIRFARKADCAAIAEIYNHAVLYTAAIWNDQTVDADNRIAWFEARTIAGYPVLVSEEDGVVTGYASFGDWRSFDGFRHTVEHSVYVHPDHQGKGLGRKLLSRLIDEARDCGKHVMVAGIESQNQASLHLHQSLGFVVTAQMPQVGTKFGRWLDLTFMQLQLDERTEPDAIG
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -9.33 | 4.7e-15 | ●●○○○ -1.4 | -1.4009674744523872 | 29101196 |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -8.98 | 3.3e-13 | ●●○○○ -1.33 | -1.3266894933797926 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)