Bacterial taxon 1392858
Locus CO715_17385
Protein ATI07335.1
L-fuculose-phosphate aldolase
Escherichia coli M12
Length 215 aa, Gene n/a, UniProt n/a
>ATI07335.1|Escherichia coli M12|L-fuculose-phosphate aldolase
MERNKLARQIIDTCLEMTRLGLNQGTAGNVSVRYQDGMLITPTGIPYEKLTESHIVFIDGNGKHEEGKLPSSEWRFHMAAYQSRPDANAVVHNHAVHCTAVSILNRPIPAIHYMIAAAGGNSIPCAPYATFGTRELSEHVALALKNRKATLLQHHGLIACEVNLEKALWLAHEVEVLAQLYLTTLAITDPVPVLSDEEIAVVLEKFKTYGLRIEE
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 1.85 | 1.6e-67 | ○○○○○ 0.93 | 0.9310690268071352 | 29101196 |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 2.82 | 3.4e-153 | ○○○○○ 1.14 | 1.1351248287425217 | 29101196 |
Retrieved 2 of 2 entries in 1.1 ms
(Link to these results)