Bacterial taxon 1392858
Locus CO715_11455
Protein ATI06267.1
leucine efflux protein
Escherichia coli M12
Length 212 aa, Gene n/a, UniProt n/a
>ATI06267.1|Escherichia coli M12|leucine efflux protein
MFAEYGVLNYWTYLVGAIFIVLVPGPNTLFVLKNSVSSGMKGGYLAACGVFIGDAVLMFLAWAGVATLIKTTPILFNIVRYLGAFYLLYLGSKILYATLKGKNNEAKSDEPQYGAIFKRALILSLTNPKAILFYVSFFVQFIDVNAPHTGISFFILATTLELVSFCYLSFLIISGAFVTQYIRTKKKLAKVGNSLIGLMFVGFAARLATLQS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -6.55 | 3.4e-19 | ●○○○○ -0.82 | -0.8203056167978062 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -6.5 | 7.8e-18 | ●○○○○ -0.81 | -0.8094560240568653 | 29101196 |
Retrieved 2 of 2 entries in 0.7 ms
(Link to these results)