Bacterial taxon 1392858
Locus CO715_09455
Protein ATI08772.1
LexA regulated protein
Escherichia coli M12
Length 97 aa, Gene n/a, UniProt n/a
>ATI08772.1|Escherichia coli M12|LexA regulated protein
MAKEQTDRTTLDLFAHERRPGRPKTNPLSRDEQLRINKRNQLKRDKVRGLKRVELKLNAEAVEALNELAESRNMSRSELIEEMLMQQLAALRSQGIV
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -8.09 | 7.2e-15 | ●●○○○ -1.14 | -1.140994540698306 | 29101196 |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -2.5 | 8.8e-6 | ○○○○○ 0.02 | 0.024084802867335428 | 29101196 |
Retrieved 2 of 2 entries in 0.6 ms
(Link to these results)