Bacterial taxon 1392858
Locus CO715_02370
Protein ATI04679.1
lipopolysaccharide core heptose(I) kinase RfaP
Escherichia coli M12
Length 265 aa, Gene n/a, UniProt n/a
>ATI04679.1|Escherichia coli M12|lipopolysaccharide core heptose(I) kinase RfaP
MVELKEPFATLWRGKDPFEEVKTLQGEVFRELETRRTLRFEMAGKSYFLKWHRGTTLKEIIKNLLSLRMPVLGADREWNAIHRLRDVGVDTMYGVAFGEKGINPLTRTSFIITEDLTPTISLEDYCADWATNPPDVRVKRMLIKRVATMVRDMHAAGINHRDCYICHFLLHLPFSGKEEELKISVIDLHRAQLRTRVPRRWRDKDLIGLYFSSMNIGLTQRDIWRFMKVYFAAPLKDILKQEQGLLSQAEAKATKIRERTIRKSL
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -10.28 | 2.7e-18 | ●●○○○ -1.6 | -1.599389834003054 | 29101196 |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -9.15 | 2.5e-17 | ●●○○○ -1.36 | -1.3625766078305965 | 29101196 |
Retrieved 2 of 2 entries in 2.2 ms
(Link to these results)