Bacterial taxon 1392858
Locus CO715_04055
Protein ATI04987.1
lipoprotein
Escherichia coli M12
Length 55 aa, Gene n/a, UniProt n/a
>ATI04987.1|Escherichia coli M12|lipoprotein
MNKFIKVALVGAVLATLTACTGHIENRDKNCSYDYLLHPAISISKIIGGCGPTAQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -2.57 | 8.9e-23 | ○○○○○ 0.01 | 0.009062289841417406 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 0.92 | 0.00029 | ○○○○○ 0.74 | 0.7386974016696852 | 29101196 |
Retrieved 2 of 2 entries in 1.8 ms
(Link to these results)