Bacterial taxon 1392858
Locus CO715_06955
Protein ATI05475.1
lipoprotein bor
Escherichia coli M12
Length 97 aa, Gene n/a, UniProt n/a
>ATI05475.1|Escherichia coli M12|lipoprotein bor
MKKMLFSAALAMLITGCAQQTFTVGNKPTAVTPKETITHHFFVSGIGQEKTVDAAKICGGAENVVKTETQQTFVNGLLGFITLGIYTPLEARVYCSQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -2.08 | 1.2e-8 | ○○○○○ 0.11 | 0.11129883682335938 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 1.23 | 0.00042 | ○○○○○ 0.8 | 0.8021257900013391 | 29101196 |
Retrieved 2 of 2 entries in 0.7 ms
(Link to these results)