Bacterial taxon 1392858
Locus CO715_17675
Protein ATI07387.1
LuxR family transcriptional regulator
Escherichia coli M12
Length 210 aa, Gene n/a, UniProt n/a
>ATI07387.1|Escherichia coli M12|LuxR family transcriptional regulator
MGKIKIVVSDQQPFMIDGIIGFLGHYPDLYEVVGGYKDLKKAIAECNKSAAQIFILGEFAGGMMGSELIKWVKSHKIDAHIITFVAKMPYIDSIKLLEAGAKGCVWKTSHPAKLNRAIDSISNGYTYFDSVHMDCEKISSRYSSDNQLTNRESEILQLIADGKTNKEIANFLQLSRKTVETHRLNIMKKLDVHSGIELIKTALRMGVCTI
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -2.86 | 1.3e-13 | ●○○○○ -0.05 | -0.051236408276503526 | 29101196 |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -1.01 | 0.013 | ○○○○○ 0.33 | 0.33455007206964094 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)