Bacterial taxon 1392858
Locus CO715_06960
Protein ATI05476.1
lysis protein
Escherichia coli M12
Length 153 aa, Gene n/a, UniProt n/a
>ATI05476.1|Escherichia coli M12|lysis protein
MNRVTAIISALVICIIVCLSWAVNHYRDNAITYKAQRDKNARELKLANAAITDMQMRQRDVAALDAKYTKELADAKAENDALRDDVAAGRRRLHIKAVCQSVREATTASGVDNAASPRLADTAERDYFTLRERLITMQKQLEGTQKYINEQCR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -5.66 | 2.7e-6 | ●○○○○ -0.63 | -0.6337760800593242 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -4.64 | 0.00022 | ●○○○○ -0.42 | -0.4228349596537255 | 29101196 |
Retrieved 2 of 2 entries in 0.9 ms
(Link to these results)