Bacterial taxon 1392858
Locus CO715_10125
Protein ATI06030.1
lysis protein S
Escherichia coli M12
Length 71 aa, Gene n/a, UniProt n/a
>ATI06030.1|Escherichia coli M12|lysis protein S
MKSMDKISTGIAYGTSAGSAGYWFLQLLDKVTPSQWAAIGVLGSLVFGLLTYLTNLYFKIKEDKRKAARGE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -4.42 | 1.1e-16 | ●○○○○ -0.38 | -0.37630689847622945 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -1.91 | 0.00021 | ○○○○○ 0.15 | 0.14697730525991465 | 29101196 |
Retrieved 2 of 2 entries in 0.7 ms
(Link to these results)