Bacterial taxon 1392858
Locus CO715_14290
Protein ATI08817.1
magnesium transporter ATPase
Escherichia coli M12
Length 215 aa, Gene n/a, UniProt n/a
>ATI08817.1|Escherichia coli M12|magnesium transporter ATPase
MTAEFIIRLILAAIACGAIGMERQMRGKGAGLRTHVLIGMGSALFMIVSKYGFADVLSLDHVGLDPSRIAAQVVTGVGFIGAGNILVRNQNIVGLTTAADIWVTAAIGMVIGSGMYELGIYGSVMTLLVLEVFHQLTFRLMNKNYHLQLTLVNGNTVSMLDWFKQKKIKTDLVSLQENEDHEVVAIDIQLHATTSIEDLLRLLKGMAGVKGVSIS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 0.82 | 1.7e-6 | ○○○○○ 0.72 | 0.7176241542305503 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 1.62 | 1.3e-22 | ○○○○○ 0.88 | 0.8841236736011415 | 29101196 |
Retrieved 2 of 2 entries in 9.4 ms
(Link to these results)