Bacterial taxon 1392858
Locus CO715_23430
Protein ATI08404.1
malate transporter
Escherichia coli M12
Length 94 aa, Gene n/a, UniProt n/a
>ATI08404.1|Escherichia coli M12|malate transporter
MTYKYNPFWQQRIRETVRHALNVHPRLTALRVDLRFPDVPAATDAAVISRFINALKARIDAYQKRKHREGKRVHPTLHLPLVWQCTQIPSAIRH
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -4.35 | 3.2e-9 | ●○○○○ -0.36 | -0.3612843854503114 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 2.67 | 0.00018 | ○○○○○ 1.1 | 1.1040365726194412 | 29101196 |
Retrieved 2 of 2 entries in 0.4 ms
(Link to these results)