Bacterial taxon 1392858
Locus CO715_06360
Protein ATI05374.1
MarC family protein
Escherichia coli M12
Length 215 aa, Gene n/a, UniProt n/a
>ATI05374.1|Escherichia coli M12|MarC family protein
MIQTLFDFPVYFKFFIGLFALVNPVGIIPVFISMTSYQTAAARNKTNLTANLSVAIILWISLFLGDTILQLFGISIDSFRIAGGILVVTIAMSMISGKLGEDKQNKQEKSETAVRESIGVVPLALPLMAGPGAISSTIVWGTRYHSISYLFGFFVAIALFALCCWGLFRMAPWLVRVLRQTGINVITRIMGLLLMALGIEFIVTGIKGIFPGLLN
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -1.69 | 1.9e-5 | ○○○○○ 0.19 | 0.19392265846590845 | 29101196 |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 1.01 | 0.017 | ○○○○○ 0.76 | 0.7562236668665895 | 29101196 |
Retrieved 2 of 2 entries in 0.5 ms
(Link to these results)