Bacterial taxon 1392858
Locus CO715_08085
Protein ATI05674.1
MBL fold metallo-hydrolase
Escherichia coli M12
Length 215 aa, Gene n/a, UniProt n/a
>ATI05674.1|Escherichia coli M12|MBL fold metallo-hydrolase
MNYRIIPVTAFSQNCSLIWCEQTRLAALVDPGGDAEKIKQEVDASGLTLMQILLTHGHLDHVGAAAELAQHYGVPVFGPEKEDEFWLQGLPAQSRMFGLEECQPLTPDRWLNEGDTISIGNVALQVLHCPGHTPGHVVFFDDRAKLLISGDVIFKGGVGRSDFPRGDHNQLISSIKDKLLPLGDDVTFIPGHGPLSTLGYERLHNPFLQDEMPVW
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -5.82 | 1.1e-12 | ●○○○○ -0.67 | -0.667159442339142 | 29101196 |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 1.84 | 0.016 | ○○○○○ 0.93 | 0.9302344427501399 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)