Bacterial taxon 1392858
Locus CO715_15535
Protein ATI06998.1
met repressor
Escherichia coli M12
Length 105 aa, Gene n/a, UniProt n/a
>ATI06998.1|Escherichia coli M12|met repressor
MAEWSGEYISPYAEHGKKSEQVKKITVSIPLKVLKILTDERTRRQVNNLRHATNSELLCEAFLHAFTGQPLPDDADLRKERSDEIPEAAKEIMREMGINPETWEY
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -13.5 | 3.6e-14 | ●●●○○ -2.27 | -2.2706040618416408 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -9.51 | 1.4e-13 | ●●○○○ -1.44 | -1.4376891729601864 | 29101196 |
Retrieved 2 of 2 entries in 6.2 ms
(Link to these results)