Bacterial taxon 1392858
Locus CO715_22740
Protein ATI08295.1
metal-dependent hydrolase
Escherichia coli M12
Length 260 aa, Gene n/a, UniProt n/a
>ATI08295.1|Escherichia coli M12|metal-dependent hydrolase
MICRFIDTHCHFDFPPFSGDEEASLQRAAQAGVGKIIVPATEAENFARVQALAEKYQPLYTALGLHPGMLEKHSDVSLDQLQQALERRPAKVVAVGEIGLDLFGDDPQFERQQWLLDEQLKLAKRYDLPVILHSRRTHDKLAMHLKRHDLPCTGVVHGFSGSLQQAERFVQLGYKIGVGGTITYPRASKTRDVIAKLPLASLLLETDAPDMPLNGFQGQPNRPEQAVRVFDVLCELRPEPEDEIAEVLLNNTYALFSVSG
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -4.82 | 2.0e-11 | ●○○○○ -0.46 | -0.45997395019002274 | 29101196 |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -3.66 | 7.6e-7 | ●○○○○ -0.22 | -0.21690134359009938 | 29101196 |
Retrieved 2 of 2 entries in 0.7 ms
(Link to these results)