Bacterial taxon 1392858
Locus CO715_19880
Protein ATI07777.1
methylated-DNA--[protein]-cysteine S-methyltransferase
Escherichia coli M12
Length 129 aa, Gene n/a, UniProt n/a
>ATI07777.1|Escherichia coli M12|methylated-DNA--[protein]-cysteine S-methyltransferase
MLVSCAMRLHSGVFPDYAEKLPQEEKMEKEDSFPQRVWQIVAAIPEGYVTTYGDVAKLAGSPRAARQVGGVLKRLPEGSTLPWHRVVNRHGTISLTGPDLQRQRQALLAEGVMVSGSGQIDLQRYRWNY
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -13.82 | 3.1e-18 | ●●●○○ -2.34 | -2.3367448483585296 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -3.91 | 1.3e-8 | ●○○○○ -0.27 | -0.26864555512381694 | 29101196 |
Retrieved 2 of 2 entries in 79.8 ms
(Link to these results)