Bacterial taxon 1392858
Locus CO715_15385
Protein ATI06974.1
MOSC domain-containing protein
Escherichia coli M12
Length 224 aa, Gene n/a, UniProt n/a
>ATI06974.1|Escherichia coli M12|MOSC domain-containing protein
MRYPVDVYTGKIQAYPEGKPSAIAKIQVDGELMLTELGLEGDEQAEKKVHGGPDRALCHYPREHYLYWAREFPEQAELFVAPAFGENLSTDGLTESNVYIGDIFRWGEALIQVSQPRSPCYKLNYHFDISDIAQLMQNTGKVGWLYSVIAPGLVSADAPLELVSRVSDVTVQEAAAIAWHMPFDDEQYHRLLSAAGLSKSWTRTMQKRRLSGKIEDFSRRLWGK
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -5.06 | 5.0e-5 | ●○○○○ -0.51 | -0.5090057635385052 | 29101196 |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 7.24 | 4.9e-23 | ○○○○○ 2.06 | 2.0558796896227465 | 29101196 |
Retrieved 2 of 2 entries in 0.6 ms
(Link to these results)