Bacterial taxon 1392858
Locus CO715_10385
Protein ATI06069.1
multidrug transporter subunit MdtJ
Escherichia coli M12
Length 121 aa, Gene n/a, UniProt n/a
>ATI06069.1|Escherichia coli M12|multidrug transporter subunit MdtJ
MYIYWILLGLAIATEITGTLSMKWASVSEGNGGFILMLVMISLSYIFLSFAVKKIALGVAYALWEGIGILFITLFSVLLFDESLSLMKIAGLTTLVAGIVLIKSGTRKARKPELEVNHGAV
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -6.56 | 1.0e-29 | ●○○○○ -0.82 | -0.8234353070115391 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 1.8 | 1.2e-6 | ○○○○○ 0.92 | 0.9208453721089411 | 29101196 |
Retrieved 2 of 2 entries in 1.1 ms
(Link to these results)