Bacterial taxon 1392858
Locus CO715_06035
Protein ATI05315.1
multiple antibiotic resistance transcriptional regulator MarR
Escherichia coli M12
Length 144 aa, Gene n/a, UniProt n/a
>ATI05315.1|Escherichia coli M12|multiple antibiotic resistance transcriptional regulator MarR
MKSTSDLFNEIIPLGRLIHMVNQKKDRLLNEYLSPLDITAAQFKVLCSIRCAACITPVELKKVLSVDLGALTRMLDRLVCKGWVERLPNPNDKRGVLVKLTTSGAAICEQCHQLVGQDLHQELTKNLTADEVATLEHLLKKVLP
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -7.49 | 2.8e-6 | ●●○○○ -1.02 | -1.01747610026298 | 29101196 |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 3.17 | 1.6e-5 | ○○○○○ 1.21 | 1.2075249956868763 | 29101196 |
Retrieved 2 of 2 entries in 0.9 ms
(Link to these results)