Bacterial taxon 1392858
Locus CO715_19325
Protein ATI07678.1
murein peptide amidase A
Escherichia coli M12
Length 242 aa, Gene n/a, UniProt n/a
>ATI07678.1|Escherichia coli M12|murein peptide amidase A
MTVTRPRAERGAFPPGTEHYGRSLLGAPLIWFPAPAASRESGLILAGTHGDENSSVVTLSCALRTLTPSLRRHHVVLCVNPDGCQLGLRANANGVDLNRNFPAANWKEGETVYRWNSAAEERDVVLLTGDKPGSEPETQALCQLIHRIQPAWVVSFHDPLACIEDPRHSELGEWLAQAFELPLVTSVGYETPGSFGSWCADLNLHCITAEFPPISSDEASEKYLFAMANLLRWHPKDAIRPL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -8.06 | 1.8e-25 | ●●○○○ -1.13 | -1.1347351602708398 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -1.19 | 0.024 | ○○○○○ 0.3 | 0.2982456655903391 | 29101196 |
Retrieved 2 of 2 entries in 1.9 ms
(Link to these results)