Bacterial taxon 1392858
Locus CO715_02920
Protein ATI04780.1
N-acetylmuramoyl-L-alanine amidase AmiA
Escherichia coli M12
Length 289 aa, Gene n/a, UniProt n/a
>ATI04780.1|Escherichia coli M12|N-acetylmuramoyl-L-alanine amidase AmiA
MSTFKPLKTLTSRRQVLKAGLAALTLSGMSQAIAKDEPLKTSNGHSKPKAKKSGGKRVVVLDPGHGGIDTGAIGRNGSKEKHVVLAIAKNVRSILRNHGIDARLTRSGDTFIPLYDRVEIAHKHGADLFMSIHADGFTNPKAAGASVFALSNRGASSAMAKYLSERENRADEVAGKKATDKDHLLQQVLFDLVQTDTIKNSLTLGSHILKKIKPVHKLHSRNTEQAAFVVLKSPSVPSVLVETSFITNPEEERLLGTAAFRQKIATAIAEGVISYFHWFDNQKAHSRKR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -8.27 | 6.1e-17 | ●●○○○ -1.18 | -1.1802199913770917 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -3.31 | 0.00038 | ●○○○○ -0.14 | -0.1442925306314957 | 29101196 |
Retrieved 2 of 2 entries in 2.2 ms
(Link to these results)