Bacterial taxon 1392858
Locus CO715_13660
Protein ATI06660.1
N-acetyltransferase
Escherichia coli M12
Length 167 aa, Gene n/a, UniProt n/a
>ATI06660.1|Escherichia coli M12|N-acetyltransferase
MNNIAPQSPVMRRLTQQDNPAIARVIRQVSAEYGLTADKGYTVADPNLDELYQVYSQPGHAYWVVEFDGEVVGGGGIAPLAGSESDICELQKMYFLPAIRGKGLAKKLALMAMEQAREMGFKRCYLETTAFLKEAIALYEHLGFEHIDYALGCTGHVDCEVRMLREL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 0.65 | 0.037 | ○○○○○ 0.68 | 0.6823629778224927 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 2.56 | 1.4e-15 | ○○○○○ 1.08 | 1.0810855110520665 | 29101196 |
Retrieved 2 of 2 entries in 1 ms
(Link to these results)