Bacterial taxon 1392858
Locus CO715_07225
Protein ATI05527.1
NAD-dependent deacylase
Escherichia coli M12
Length 273 aa, Gene n/a, UniProt n/a
>ATI05527.1|Escherichia coli M12|NAD-dependent deacylase
MLSRRGHRLSRFRKNKRRLRERLRQRVFFRDKVVPEAMEKPRVLVLTGAGISAESGIRTFRAADGLWEEHRVEDVATPEGFDRDPELVQAFYNARRRQLQQPEIQPNAAHLALAKLQDALGDRFLLVTQNIDNLHERAGNTNVIHMHGELLKVRCSQSGQVLDWTGDVTPEDKCHCCQFPAPLRPHVVWFGEMPLGMDEIYMALSMADIFIAIGTSGHVYPAAGFVHEAKLHGAHTVELNLEPSQVGNEFAEKYYGPASQVVPEFVEKLLKGL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -9.23 | 5.8e-5 | ●●○○○ -1.38 | -1.3801028730275007 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -3.89 | 0.05 | ●○○○○ -0.27 | -0.2661418029528306 | 29101196 |
Retrieved 2 of 2 entries in 1.3 ms
(Link to these results)