Bacterial taxon 1392858
Locus CO715_19320
Protein ATI07677.1
NAD-dependent dehydratase
Escherichia coli M12
Length 212 aa, Gene n/a, UniProt n/a
>ATI07677.1|Escherichia coli M12|NAD-dependent dehydratase
MKNVLILGAGGQIARHVINQLADKQTIKQTLFARQPAKIHKPYPTNSKIIMGDVLNHAALKQAMQGQDVVYANLTGEDLDIQANSVIAAMKACDVKRLIFVLSLGIYDEVPGKFGEWNNAVIGEPLKPFRRAADAIEASGLEYTILRPAWLTDEDIIDYELTSRNEPFKGTIVSRKSVAALITDIIDKPEKHIGENIGINQPGTDGDKPFFM
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -3.51 | 6.4e-50 | ●○○○○ -0.19 | -0.18685631753826332 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 0.8 | 0.00033 | ○○○○○ 0.71 | 0.713451233945573 | 29101196 |
Retrieved 2 of 2 entries in 2.4 ms
(Link to these results)