Bacterial taxon 1392858
Locus CO715_23510
Protein ATI08416.1
NfeD family protein
Escherichia coli M12
Length 152 aa, Gene n/a, UniProt n/a
>ATI08416.1|Escherichia coli M12|NfeD family protein
MMELMVVHPHIFWLSLGGLLLAAEMLGGNGYLLWSGVAAVITGLVVWLVPLGWEWQGVMFAVLTLLAAWLWWKWLSRRVREQKHSDSHLNQRGQQLIGRRFVLESPLVNGRGHMRVGDSSWPVSASEDLGAGTHVEVIAIEGITLIIRAVIV
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -7.07 | 0.01 | ●○○○○ -0.93 | -0.9285928981929651 | 29101196 |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -2.21 | 5.3e-28 | ○○○○○ 0.08 | 0.08459214699950511 | 29101196 |
Retrieved 2 of 2 entries in 1.1 ms
(Link to these results)