Bacterial taxon 1392858
Locus CO715_14545
Protein ATI06822.1
nickel ABC transporter permease subunit NikC
Escherichia coli M12
Length 277 aa, Gene n/a, UniProt n/a
>ATI06822.1|Escherichia coli M12|nickel ABC transporter permease subunit NikC
MNFFLSSRWSVRLALIIIALLALIALTSQWWLPYDPQAIDLPSRLLSPDAQHWLGTDHLGRDIFSRLMAATRVSLGSVMACLLLVLTLGLVIGGSAGLIGGRVDQATMRVADMFMTFPTSILSFFMVGVLGTGLTNVIIAIALSHWAWYARMVRSLVISLRQREFVLASRLSGAGHVRVFVDHLAGAVIPSLLVLATLDIGHMMLHVAGMSFLGLGVTAPTAEWGVMINDARQYIWTQPLQMFWPGLALFISVMAFNLVGDALRDHLDPHLVTEHAH
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 1.28 | 8.2e-10 | ○○○○○ 0.81 | 0.8131840287565287 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 2.37 | 4.5e-29 | ○○○○○ 1.04 | 1.0408168303020364 | 29101196 |
Retrieved 2 of 2 entries in 8.6 ms
(Link to these results)