Bacterial taxon 1392858
Locus CO715_14530
Protein ATI06819.1
nickel-responsive transcriptional regulator NikR
Escherichia coli M12
Length 133 aa, Gene n/a, UniProt n/a
>ATI06819.1|Escherichia coli M12|nickel-responsive transcriptional regulator NikR
MQRVTITLDDDLLETLDSLSQRRGYNNRSEAIRDILRSALAQEATQQHGTQGFAVLSYVYEHEKRDLASRIVSTQHHHHDLSVATLHVHINHDDCLEIAVLKGDMGDVQHFADDVIAQRGVRHGHLQCLPKED
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -8.75 | 3.9e-13 | ●●○○○ -1.28 | -1.2799527861880475 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 6.04 | 3.6e-20 | ○○○○○ 1.81 | 1.8061304105668594 | 29101196 |
Retrieved 2 of 2 entries in 1.6 ms
(Link to these results)