Bacterial taxon 1392858
Locus CO715_09080
Protein ATI05857.1
nicotinamide riboside transporter PnuC
Escherichia coli M12
Length 239 aa, Gene n/a, UniProt n/a
>ATI05857.1|Escherichia coli M12|nicotinamide riboside transporter PnuC
MDFFSVQNILVHIPIGAGGYDLSWIEAVGTIAGLLCIGLASLEKISNYFFGLINVTLFGIIFFQILLYASLLLQVFFFAANIYGWYAWSRQTSQNEAELKIRWLPLPKALSWLAVCVVSIGLMTVFINPVFAFLTRVAVMIMQALGLQVAMPELQPDAFPFWDSCMMVLSIVAMILMTRKYVENWLLWVIINVISVVIFALQGVYAMSLEYIILTFIALNGSRMWINSARERGSRALSH
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -8.26 | 0.0074 | ●●○○○ -1.18 | -1.1764643631206124 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -6.33 | 0.0023 | ●○○○○ -0.78 | -0.7752380777200522 | 29101196 |
Retrieved 2 of 2 entries in 1.9 ms
(Link to these results)