Bacterial taxon 1392858
Locus CO715_16870
Protein ATI07240.1
nicotinamide-nucleotide amidohydrolase PncC
Escherichia coli M12
Length 165 aa, Gene n/a, UniProt n/a
>ATI07240.1|Escherichia coli M12|nicotinamide-nucleotide amidohydrolase PncC
MTDSELMQLSEQVGQALKARGATVTTAESCTGGWVAKVITDIAGSSAWFERGFVTYSNEAKAQMIGVREETLAQHGAVSEPVVVEMAIGALKAARADYAVSISGIAGPDGGSEEKPVGTVWFAFATARGEGITRRECFSGDRDAVRRQATAYALQTLWQQFLQNT
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -6.05 | 2.1e-13 | ●○○○○ -0.72 | -0.716608547716122 | 29101196 |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 4.33 | 9.3e-12 | ○○○○○ 1.45 | 1.450388956272551 | 29101196 |
Retrieved 2 of 2 entries in 1.1 ms
(Link to these results)