Bacterial taxon 1392858
Locus CO715_04070
Protein ATI04990.1
nitrite reductase small subunit
Escherichia coli M12
Length 108 aa, Gene n/a, UniProt n/a
>ATI04990.1|Escherichia coli M12|nitrite reductase small subunit
MSQWKDICKIDDILPETGVCALLGDEQVAIFRPYHSDQVFAISNIDPFFESSVLSRGLIAEHQGELWVASPLKKQRFRLSDGLCMEDEQFSVKHYDARVKDGVVQLRG
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -10.67 | 0.00064 | ●●○○○ -1.68 | -1.6797185494888656 | 29101196 |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -10.25 | 0.0019 | ●●○○○ -1.59 | -1.5920872235043437 | 29101196 |
Retrieved 2 of 2 entries in 1.9 ms
(Link to these results)