Bacterial taxon 1392858
Locus CO715_00320
Protein ATI04316.1
nitrogen regulatory protein P-II 1
Escherichia coli M12
Length 112 aa, Gene n/a, UniProt n/a
>ATI04316.1|Escherichia coli M12|nitrogen regulatory protein P-II 1
MKKIDAIIKPFKLDDVREALAEVGITGMTVTEVKGFGRQKGHTELYRGAEYMVDFLPKVKIEIVVPDDIVDTCVDTIIRTAQTGKIGDGKIFVFDVARVIRIRTGEEDDAAI
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -5.52 | 2.2e-13 | ●○○○○ -0.61 | -0.6062348061784744 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -4.83 | 2.1e-11 | ●○○○○ -0.46 | -0.4618517643182626 | 29101196 |
Retrieved 2 of 2 entries in 0.6 ms
(Link to these results)