Bacterial taxon 1392858
Locus CO715_11245
Protein ATI06227.1
NTP pyrophosphohydrolase
Escherichia coli M12
Length 135 aa, Gene n/a, UniProt n/a
>ATI06227.1|Escherichia coli M12|NTP pyrophosphohydrolase
MKMIEVVAAIIERDGKILLAQRPAHSDQAGLWEFAGGKVEPDESQRQALVRELREELGIEAAVGEYVASHQREVSGRIIHLHAWHVPDFHGTLQAHEHQALVWCSPEEALQYPLAPADIPLLEAFMALRAARPAD
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -8.79 | 4.3e-6 | ●●○○○ -1.29 | -1.2880899807437531 | 29101196 |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -3.38 | 0.017 | ●○○○○ -0.16 | -0.15827181358616935 | 29101196 |
Retrieved 2 of 2 entries in 0.4 ms
(Link to these results)