Bacterial taxon 1392858
Locus CO715_00105
Protein ATI04276.1
nucleoside-diphosphate kinase
Escherichia coli M12
Length 143 aa, Gene n/a, UniProt n/a
>ATI04276.1|Escherichia coli M12|nucleoside-diphosphate kinase
MAIERTFSIIKPNAVAKNVIGNIFARFEAAGFKIVGTKMLHLTVEQARGFYAEHDGKPFFDGLVEFMTSGPIVVSVLEGENAVQRHRDLLGATNPANALAGTLRADYADSLTENGTHGSDSVESAAREIAYFFGEGEVCPRTR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -10.79 | 1.4e-8 | ●●○○○ -1.71 | -1.7057993012699733 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -8.99 | 4.5e-7 | ●●○○○ -1.33 | -1.3294018915650279 | 29101196 |
Retrieved 2 of 2 entries in 8.3 ms
(Link to these results)